SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001897715.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001897715.1.25112
Domain Number 1 Region: 347-471
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-19
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 
Domain Number 2 Region: 134-356
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-18
Family DBL homology domain (DH-domain) 0.0094
Further Details:      
 
Domain Number 3 Region: 524-558
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000046
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001897715.1.25112
Sequence length 618
Comment PH domain containing protein [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MRSSVISDGSWIDFQLSSPLSSEIESLCSEQSFDCSEERAENTNEKTLIAEKNFESDVTL
TSKDVMVYSSNIAGNSKIRKSRNLESNCELLLSCDSEATSSRPSSDAYSLTNTLCRTSIV
SPTIMDTVYNTGSQEEDQRLKKLHYAAVEIYTVEKKFVEQLELIAVKYPEFLTKYGKELG
IDFLKTLPNGYPHLINRIAQQLLMVKEAHKFLLEKISSKIENWDSRVPSMAECLKNGAGL
LKCCLPYLKEKRKHVDDFIRLLQENEELARATTKFEEEVMGKISIIQQLDIVHQNVVRYT
ILLEAYKKHLVPESDELGVCMDALVQLSKVSELVDRQISRAELEKRLIDLYRQLEGRFNV
FEANRHLLFEGELMKQSRKDLQPRYLILFSDVLLICKYSRTPSLGTDANFHSEFYKFLVS
RIRVKAEEHGEYETHFQLYTTQKSAVFIAKTKRERDDWVKRISEAKMEAKELRHIKAARN
KILNVRVMHVDEPTDECTSDTKTSNNGLDNGISLSITGKHKYTPLWIPDPKATSCMMAGC
STKFNVLNRRHHCRECGYDVDPVARYVLIGFTLCVQELDDGGRLFELRHANQVNKSSCIS
LHFRVAHSGSAERLFIWR
Download sequence
Identical sequences XP_001897715.1.25112 Bm1_31350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]