SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001921829.2.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001921829.2.45394
Domain Number 1 Region: 62-331
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.16e-40
Family TehB-like 0.072
Further Details:      
 
Domain Number 2 Region: 1847-1904
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.71e-22
Family Tudor domain 0.00013
Further Details:      
 
Domain Number 3 Region: 1905-1960
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000001
Family Tudor domain 0.0001
Further Details:      
 
Domain Number 4 Region: 1678-1716
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000155
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001921829.2.45394
Sequence length 2012
Comment lysine-specific demethylase 4A isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MASDSVSQSSQSPATRIMTFHPTKEEFKDFNRYIAYMESQGAHRAGMAKVVPPKDWKPRR
TYDDIEDLVIPTPIQQVVTGQSGLFTQYNIQKKPMTVREFRKTANTDKFSNPRYADFEEL
ERKFWKNLTFNPPLYGADVSGTLYDPDVMEWNIGRLNTILDMVERESGITIKGVNTPYLY
FGMWKSTFAWHTEDMDLYSINYLHFGEPKSWYVVPPEHGKRLERLAKGFFPGSAQSCEAF
LRHKMTLISPSILRKYGIPFEKVTQEAGQFIVTFPYGYHAGFNHGFNCAESTNFATQRWI
DYGKLATLCSCRKDMVKISMDVFVHKFQPERYKLWKAGKDNVPIDHSKPTPEVAEIQKEN
EKGEISDSERAETLEERGEAEAGDQQKANTDDGEEDKAEAFSEKVVKRESDAGKEKAEAE
VEKSVRDEEPSSTSEQISSSSPKQNTGQKRLRSSTDNEAKDDNQVKIEVEEVEKKKAKLG
QNETDNNEEQSVSAEPDDEKAEETMETDTPPPQQQECMEAELSTSDPTSSSDITTQQREE
ESSDVTSSTQSINSVDEDVALGGDVASQSEDVTQSFVVQINPEDITPTDLTDAQPSNITS
HPCSSDIPATSFMSVSSSNFSKHSISFAYTCDGTTEPSDSINLTPRVPSINVAHISDVQP
EPSDIIVSLKQNSSANSTYTSDVQSDLSNVTVDPEHKPSINSTHIINVQSETSNITISSE
HEPSISSTPMSDVQSETSFKYEPGNNSAYVCDVKPEHSDISMSPIYKPGVNFAHTSDVQP
EPSECESCTNSDHICDVQSEANDIIINSKDEMSINSAHTFDVQPEPSDNTVSLTHKPDIS
STSGSDVPSGPGDITDSLGYDPDFNSTHTGHVQSESNNSPKHKLPINSAHTYDVQSGPSD
ITDGHRFESEFNSTHICDVQSGPSDMSVNSKRKSSIDSAQIDDAQSDPSDISIGSKQEYS
INSAQIDNVQSEPSDISIGSKQESSINSAQIDNVQSEPSNISISSKQETSINSTQIDDVQ
SEPSDISISSKNKLRINSAQIDDVQSAPSGISVSSEQETSIISAQVDDVQSEYSDISISS
KHEPSINSTQTDDIQSEPIDISFGSKQESCINSAQMYDVQSEPSDISISSTQETSINSAQ
MYDVQLEPSDISISFKDKPSINSSQVDDVQSEPSDICFGSEQETCINSAQIYDVQSEPSN
ISFSSKQETSINSTQMYDVQSEPSDISISSNQETSINSTQMYDVQSEPSDISISSNQETS
INSTQMYDVQSEPSDISISSNQETSINSTQMHDVQSEPSDISISSNQETTINSTQMYDVQ
SDPSDISISSKHKPSINSARMYDVQSEPSDISISSKHNPSIDSTQMFDVQSEPSDFSISS
KHKPSIDSTQIYDVQSAPSGLTISYKQKTSINSAQMYEVQSEPSDFSVSSKRKPSIDSIH
MYDDVQLKSSNFMVSRTPEPTYKIIPEPSSSVSVNVSGLSSVLASVSQGSVQHIFQRTLS
PAEVLHVHSYAKGDYSDIEPRIQHERDSDSDSESQDDNKKEAERPAEAQYRLPRLPRHHP
LIKDSISDEELQDQAASEEDGLDGEAWARPLTQLWQNRPYNPDREREYNREMGLRPPYCS
ICMLFQAHHRSEGAESEPAVVLRGGQMRTKPLIPERCFTITTEESADVQPSTAHLEEDGT
SLLISCSLCSVRVHTSCYGVASGRVSKDWKCARCKANAFAESCCLCSLRGGALHRANNGK
WVHVLCAVAVQEARFVNITERSPVDLSGIPLQRFKLKCYYCKRRMKKTLGCCVQCSHGRC
PTSYHPTCAQAAGVIMHPDDWPFVVYVTCCRHKGPVQSERNKSAMRELSVGQRVICKHKN
GRYYQCEVIQLTKETFYEVNFDDGSFSDNLFPEDIVNRDCAQLGPPPQGEVVQVRWTDGL
VYGAKFVAAHVIQMYQVEFEDGSLLTAKRDDVYTLDEELPKRVKSRLSKASDMRFDGMFG
EKKVQESKRQRVINSRYRGDYIEPVIYRAIME
Download sequence
Identical sequences I3ITH4
ENSDARP00000126239 XP_001921829.2.45394 ENSDARP00000126239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]