SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001973093.2.56816 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001973093.2.56816
Domain Number 1 Region: 40-96
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000246
Family Tachycitin 0.022
Further Details:      
 
Domain Number 2 Region: 138-187
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000314
Family Tachycitin 0.0057
Further Details:      
 
Domain Number 3 Region: 213-268
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000012
Family Tachycitin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001973093.2.56816
Sequence length 277
Comment uncharacterized protein Dere_GG13542 [Drosophila erecta]; AA=GCF_000005135.1; RF=representative genome; TAX=7220; STAX=7220; NAME=Drosophila erecta; strain=TSC#14021-0224.01; AL=Scaffold; RT=Major
Sequence
MMLNTAFYLMVSCLLATAQKAWSPSKPTNSVTIRQSGSIFCANHLVGEFVEHAEDCHMFY
LCVENGDAILASCPPTMLFNTESRLCDSAANVKCRNGTDGMENPPLEAGNGDGDPNDMVT
DAATYCSTLMNQQQSSDRIVYVGSSSSCRKYYICYYGQAILQECSSQLHWNALTGKCDIP
EKAQCTVGGQGDIPSNGSPSFPSAGSSISSDLIHCPAYGQHLYPHMQRCEFFIYCVKGHA
SLQQCPFYYFFDIATKSCQWSRTAQCVLDLNLVPLIK
Download sequence
Identical sequences B3NI33
XP_001973093.2.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]