SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001975723.1.56816 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001975723.1.56816
Domain Number 1 Region: 43-120
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000000529
Family Snake venom toxins 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001975723.1.56816
Sequence length 155
Comment uncharacterized protein Dere_GG20404, isoform A [Drosophila erecta]; AA=GCF_000005135.1; RF=representative genome; TAX=7220; STAX=7220; NAME=Drosophila erecta; strain=TSC#14021-0224.01; AL=Scaffold; RT=Major
Sequence
MSPFMEKTLLLLGVLCCIQVTTALMCYDCNSEFDPRCGDPFEPYSIGEVNCSKQEPLEHL
KDKYKPTLCRKTVQKIYGKTRIVRGCGYIPDENTDNKCVRRSGTHDVAAIYCSCTKDLCN
GANSNAGQWMMLPLVLAAGLALLLNSRHTIRFQSS
Download sequence
Identical sequences B3NRH1
XP_001975723.1.56816 XP_015011646.1.56816 XP_015011647.1.56816 FBpp0138950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]