SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001983641.1.65300 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001983641.1.65300
Domain Number 1 Region: 32-91
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000027
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001983641.1.65300
Sequence length 92
Comment GH15461 [Drosophila grimshawi]; AA=GCF_000005155.2; RF=representative genome; TAX=7222; STAX=7222; NAME=Drosophila grimshawi; strain=TSC#15287-2541.00; AL=Scaffold; RT=Major
Sequence
MKFILILACLALFVAHTQAQQCRGRLLPNAQFCIGGRDEGISFRRDCETNANPNMWWYDG
SDRTCKTMSYRGCGGNRNRYCTRQDCEARCRR
Download sequence
Identical sequences B4J2D0
XP_001983641.1.65300 FBpp0149367 7222.FBpp0149367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]