SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002017640.1.64850 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002017640.1.64850
Domain Number 1 Region: 32-57,175-352
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.79e-61
Family G proteins 0.000000144
Further Details:      
 
Domain Number 2 Region: 61-182
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 7.33e-43
Family Transducin (alpha subunit), insertion domain 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002017640.1.64850
Sequence length 354
Comment GL17293 [Drosophila persimilis]; AA=GCF_000005195.2; RF=representative genome; TAX=7234; STAX=7234; NAME=Drosophila persimilis; strain=MSH-3; AL=Scaffold; RT=Major
Sequence
MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESG
FTAEDFKQYRPVVYSNTIQSLVAILRAMPNLSIQYSNNERESDAKMVFDVCQRMHDTEPF
SEELLAAMKRLWQDTGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRV
KTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDET
TNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEA
AAYIQAQFEAKNKSTSKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY
Download sequence
Identical sequences B4GG59 Q28XI2
FBpp0275989 7237.FBpp0275989 FBpp0181400 XP_001361755.1.19638 XP_002017640.1.64850 XP_017146376.1.22881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]