SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002026776.1.64850 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002026776.1.64850
Domain Number 1 Region: 16-159
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.47e-41
Family Cofilin-like 0.000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002026776.1.64850
Sequence length 163
Comment GL26993 [Drosophila persimilis]; AA=GCF_000005195.2; RF=representative genome; TAX=7234; STAX=7234; NAME=Drosophila persimilis; strain=MSH-3; AL=Scaffold; RT=Major
Sequence
MSDGIEVEQIVESKPRRMPLATSLDKDAIREAYEDVRSDLTDTEWAVFKFDGPQIIVHGR
GQCFEEFRQQFGDSERAFGYIRIQMGDEMSKRKKFIFLTWIGQEVGVIQRAKMSTDKAII
KDVLNNFAVELQAGVEPELDIGLFREALNRAGGANYGTGIRDN
Download sequence
Identical sequences B4H7E7
FBpp0191100 XP_002026776.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]