SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002033754.1.34323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002033754.1.34323
Domain Number 1 Region: 43-120
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000000515
Family Snake venom toxins 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002033754.1.34323
Sequence length 155
Comment GM21492 [Drosophila sechellia]; AA=GCF_000005215.3; RF=representative genome; TAX=7238; STAX=7238; NAME=Drosophila sechellia; strain=Rob3c; AL=Scaffold; RT=Major
Sequence
MSPFMEKTLLLLGVLCCIQVTTALMCYDCNSEFDPRCGDPFEPYSIGEVNCSKQEPLEHL
KDKYKPTLCRKTVQKIYGKTRIVRGCGYIPDENTDNKCVRRSGTHDVAAIYCSCTKDLCN
GANSPAGQWMMLPLIVVAGLALLLNSRHTIRFQSS
Download sequence
Identical sequences B4HQX0
FBpp0202969 XP_002033754.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]