SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002046226.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002046226.1.90633
Domain Number - Region: 75-112
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0471
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002046226.1.90633
Sequence length 127
Comment uncharacterized protein Dvir_GJ12783 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MPDNQLDDSDDKPKKSKKKWVMCCPKDLPKKPKPEPKIELPKPVVCEPIEKPPKKPKKAE
KPACERPAHYRSGSEQRAYLEKEVVPILMEGMLALARDQPRDPISYLEKFWLEEQQKCDI
PLPEDLL
Download sequence
Identical sequences B4LI24
FBpp0227200 XP_002046226.1.90633 7244.FBpp0227200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]