SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002078067.1.80810 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002078067.1.80810
Domain Number 1 Region: 71-129
Classification Level Classification E-value
Superfamily BPTI-like 1.22e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002078067.1.80810
Sequence length 131
Comment uncharacterized protein Dsimw501_GD22732 [Drosophila simulans]; AA=GCF_000754195.2; RF=representative genome; TAX=7240; STAX=7240; NAME=Drosophila simulans; strain=w501; AL=Chromosome; RT=Minor
Sequence
MLLRVTQFLCLGALVLLSLMQLTQAVATPNNNNNNNNNIKPKAVVQVQPGNPPGIKPAVA
TTTTTIKPQRLVPDPKCLQPLEVGPCRMSLERFYYNKDKKACETFKYGGCRGNDNRWGFR
QTCEEACIPKK
Download sequence
Identical sequences B4Q9P1
XP_002078067.1.80810 FBpp0221134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]