SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002080091.1.80810 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002080091.1.80810
Domain Number - Region: 70-126
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0439
Family Extracellular domain of cell surface receptors 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002080091.1.80810
Sequence length 148
Comment uncharacterized protein Dsimw501_GD24290 [Drosophila simulans]; AA=GCF_000754195.2; RF=representative genome; TAX=7240; STAX=7240; NAME=Drosophila simulans; strain=w501; AL=Chromosome; RT=Minor
Sequence
MVSALKCSLAVAVMISLACSAYAIKCYQCESLTMPKCGLKFEADETLLLDCSRIGPPRYL
QNFFPLRNATGCMKKTLESVAGHPQIVRSCYFGDINNIQAGCQSDPSMPFVKQLGCDVCT
KDECNGSSSLAPIAGAILLFFGVARLLA
Download sequence
Identical sequences B4Q3W0 Q9VII1
FBpp0080956 NP_610069.2.81976 XP_002080091.1.80810 FBpp0222692 7227.FBpp0080956 FBpp0080956 FBpp0080956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]