SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002087859.1.41174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002087859.1.41174
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily BPTI-like 8.51e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002087859.1.41174
Sequence length 84
Comment uncharacterized protein Dyak_GE17972 [Drosophila yakuba]; AA=GCF_000005975.2; RF=representative genome; TAX=7245; STAX=7245; NAME=Drosophila yakuba; strain=Tai18E2; AL=Chromosome; RT=Major
Sequence
MKLFIFVFVFIAFAASALALKNEICGLPHSRDGDAERNIACEAYFPSWSYDSNNNKCVKF
IYGGCGGNANRFGTKERCEEVCLE
Download sequence
Identical sequences B4NY00
7245.FBpp0262982 XP_002087859.1.41174 FBpp0262982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]