SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002099570.2.41174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002099570.2.41174
Domain Number 1 Region: 101-553
Classification Level Classification E-value
Superfamily Sema domain 1.7e-122
Family Sema domain 0.0000215
Further Details:      
 
Domain Number 2 Region: 1516-1641,1852-2037
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.16e-42
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 905-994
Classification Level Classification E-value
Superfamily E set domains 0.00000000000035
Family Other IPT/TIG domains 0.026
Further Details:      
 
Domain Number 4 Region: 555-606
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000903
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 1113-1183
Classification Level Classification E-value
Superfamily E set domains 0.000000000028
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 
Domain Number 6 Region: 995-1074
Classification Level Classification E-value
Superfamily E set domains 0.000000042
Family Other IPT/TIG domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002099570.2.41174
Sequence length 2072
Comment uncharacterized protein Dyak_GE14532 [Drosophila yakuba]; AA=GCF_000005975.2; RF=representative genome; TAX=7245; STAX=7245; NAME=Drosophila yakuba; strain=Tai18E2; AL=Chromosome; RT=Major
Sequence
MELMPKRNYKQLQYTKTKIIMLRNEFYCANLIHVLHGLCIITIIGSQHYSVSCFEELPAQ
VMSPLNDIVAQFNLPSIPAQSTESPYGNRSIGNQVENVGDSQSKNYFTHLSFDFMHNVIF
AGATNKILKLNENLRVLAEAVTGPVHDSPQCHAGGCPEEIETSLVNNFNKILVVSYAHDG
ILIACGSIRQGACEIYSLPRFPAPPEFFAVPLAANDENASTYAFVGPSRYTWKEEDILYV
GTTFTNVGDYRHDVPAISSRRLDDLNYAEFSIQQSIINIDVKYRDHFLVDYLYGFNSSEY
AYFIIVQKKSHLADEAGYVTRLARICITDPNYDSYTEITIQCTATENNVDYNILRDAKIT
TASHKLAQKMGIKKDDHVLITVFSPSKEISNQPESKSAMCIYSIKDIEDMFIENIHLCFN
GTIKDRNLGYISGTINDGRCPIVGSLGNIYNFCSVGLKISGVSPITAHALFHFENVSVTS
VTATSTTDQQHSLAFLGTSKGVIKKVLLSGQSPGEYEEIVVDAGNRILPNTMMSPKKDFL
YVLSQRKITKLRIEHCSVYTNCSACLESRDPFCGWCSLERRCTVRSTCQRDTSASRWLSL
GSGQQCIEFESIIPDKIPISELTHLHLIIRTLPEPFNAKYRCVFGNSTPIDAEILENGLG
CATPPLNERPLIPTNTDHILVPLSVRSSETNKDFVSRYFAFFDCSHHGKCQECLQSSWGC
NWCIFDNKCVHKSLQCRNIENSVSTLGHCPHLKKNRPEILIPVRVPIEIRLEIENLPKPK
STHAGFLCTIHIEAAQMLLPAHVESNKIVVCEKTPYFYETNAHEYQAKVVVTWNFQHYVD
TAIVTLYKCDVLGSHREHADCSLCVTRDPKYKCAWCSNSCVYNETCIANRISSSSGSEAA
IENECPLPRIDIIKPLSGPVEGGTLITIEGSNLGIREEDVRGKIFIGSVPCELENYQISV
KIECRTGAALYEMSAPIKVANDAGYTESSVQFHFKNVLLTGLYPTIGPRSGGTQLSLIGK
FLNIGSTMRAFLDEYECHIDVTQASSSQVSCTTSEATQPEPIRSLHLVIDGANRTLECHL
SAPSITNTNPNRSNFGSYQLRTPPRQPCSIFNYTQDPRIMQIKPLRSFVSGGRVLTVHGI
YLNSIQKPELEVFYDNERVNKTSCVVINSNQMECPSPPVNYKFETFKKTNRVPDTELHLQ
NLSSPTESRFKNEYDRKKRLTDFGDNFRIYTTGGTSASYFVNNNMDVTTFVKVHETQLNL
QISFVMDNVQLVRNLNKYFHDIRSTIVYLADPKYLAFPNDGVKLYKGDSLVIEGELLNLA
ADEYDVNVTIGTSQCNITSLALTQLLCIPPEQQPLPTDENGVDQSTDLPLVVVKVGRNLR
FVIGYLKYDLNKPYVFSHALFVVILTVALLVIVFVTVLIIFRRKSTQAEREYKRIQIQMI
TLESNVRSECKQAFAELQTDMTDLTADLESTGIPTLDHVNYIMKVFFPGVSDHPILNSPK
FRGGVPQTNYDAAMIQFEQLIGNKYFLLMFIETLEAQRSSFSIRDRVNVASLLMVVLMNK
MEYATEILKSLLLRLIDKSLTSKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEYAGSNL
FLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDDLDEKVQCRVN
DWDTISQVKLKILDAIFKNTPFSMRPSVHEVDLEWRHGRGGHLTLQDEDLTTKTVNGWKR
LNTLAHYGVKESAVMSLIARQNDNYHIPYSKNQNSAPYHNFYFINNSQSHIIINNDIESG
LQQPRLYHLVKPNIPDHYMNIKNSVLSGGSPAFQSSHVVSNCIDRVNKTIPEVYLTRLLA
TKGTIQKFVDDFFSIILTVNEELPPAVKWLFDLLDEAARRHDIADTEIVHAWKSNCLPLR
FWVNFIKNPDFIFDVNKTYSVDSCLSVIAQTFMDACSTSEHRLGKDSPSNKLLFAKDIPN
YRIMVKEFYRDVSKLPQISDQEMSTAMQQLSVRQNEEFDTISALKELYIYITKYKDQIME
SLETDINCRKMHLSRKLGNVAAILDGDCTSNC
Download sequence
Identical sequences B4PVX7
XP_002099570.2.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]