SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002101310.1.41174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002101310.1.41174
Domain Number - Region: 30-126
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000515
Family Snake venom toxins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002101310.1.41174
Sequence length 149
Comment uncharacterized protein Dyak_GE15693 [Drosophila yakuba]; AA=GCF_000005975.2; RF=representative genome; TAX=7245; STAX=7245; NAME=Drosophila yakuba; strain=Tai18E2; AL=Chromosome; RT=Major
Sequence
MWPPIHAHFGWLLSLALVVLLMSLQMVTVSGIECYVCDTSDTEHPFQCGEWFERYDIPDI
QPQNCSSVHGAQFCVKHVGRFEGGIGAKRFCSSKDMGNYCDYVRNKGDRMDYRSCIYTCD
TDGCNAAGRLELEWGVAAALLTLTWLLRH
Download sequence
Identical sequences B4Q1C9
7245.FBpp0260703 FBpp0260703 XP_002101310.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]