SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002134523.2.19638 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002134523.2.19638
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.84e-31
Family Cofilin-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002134523.2.19638
Sequence length 153
Comment uncharacterized protein Dpse_GA22341 [Drosophila pseudoobscura pseudoobscura]; AA=GCF_000001765.3; RF=representative genome; TAX=46245; STAX=7237; NAME=Drosophila pseudoobscura pseudoobscura; strain=MV2-25; AL=Chromosome; RT=Major
Sequence
MMESGIQITRDSKDAFEEIWKKRTHRYAVFAVQENREIIVDALGKRDASYDDFLADLQGE
QDEDGACQCRFAIYDFEYEHHFKPMDSSTSKLKLILVLWCPEQARIRDKMIYSSSMCSII
RAFIGVQKYIQANNLDDISREAVEMQLRAMDKD
Download sequence
Identical sequences B5DNP9
XP_002134523.2.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]