SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002171576.1.46972 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002171576.1.46972
Domain Number 1 Region: 21-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.31e-33
Family PDI-like 0.0022
Further Details:      
 
Domain Number 2 Region: 320-458
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.62e-32
Family PDI-like 0.00021
Further Details:      
 
Domain Number 3 Region: 232-354
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.29e-20
Family PDI-like 0.00022
Further Details:      
 
Domain Number 4 Region: 137-224
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000195
Family PDI-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002171576.1.46972
Sequence length 508
Comment protein disulfide isomerase [Schizosaccharomyces japonicus yFS275]; AA=GCF_000149845.2; RF=representative genome; TAX=402676; STAX=4897; NAME=Schizosaccharomyces japonicus yFS275; strain=yFS275; AL=Scaffold; RT=Major
Sequence
MKRGVIFNTFFALLTGLASLVSAEVPSLNEDSLNELVKTEPLVMVKFFAPWCGHCKNLAP
EYEAAAEQLKEEDIELVEVDCTQEAEFCQKSGVRGYPTLQVYHNGENVGTYSGARKQDAI
VKYMQKLLLPAVTPVTNENVKDFISQDQFTVVGLFDDDKKNETFTNLAEKLRDDYAFGAS
SDAKVAKALNVTIPAIVAFNNLEDGEAFVYSAKEWNDDDIVKHLVSSRILLIDELQQSNY
ATYMQDGKPMGIVFYESPESREELVALFKPLAKTYKENTNIVFLDANRYGGFAEKLNLEQ
KWPAFAIHDVQQQQKYPFESTDLTNESVGEFLEKFAKGELTPSIKSEPIPEEQDNLYVVV
ANSFNDVVLDTTKDVLIEFYAPWCGYCKKLAPTYEELADQYAGEDRVVIAKIDATANDVP
VQISGFPTIMLFKADDKENPVRYEGSRTLEDLVEFVKTNGAFEAAPVPIEKEEEAAESAE
TAETAETAAKVEEEVKEQKGEEDVEDEL
Download sequence
Identical sequences B6JV82
SJAG_00288T0 XP_002171576.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]