SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002279990.2.54126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002279990.2.54126
Domain Number 1 Region: 186-252
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.17e-22
Family DNA-binding domain from rap30 0.0023
Further Details:      
 
Domain Number 2 Region: 10-120
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 4.18e-17
Family Rap30/74 interaction domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002279990.2.54126
Sequence length 260
Comment PREDICTED: general transcription factor IIF subunit 2 isoform X1 [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence
MEEEQGNSSSSNLETGKAERSVWLMKCPLAVSKSWQSHSSSESQPVAKVVLSLDPLRSED
PSALEQFTMEMTGTGAPNMPKSYSLNMFKDFVPMCVFSETNQGRVAMEGKVEHKFDMKPH
NENIEEYGKLCRERTNKSMIKNRQIQVIDNDRGVHMRPMPGMVGLIASNSKDKKKTAPVK
GSDMKRTRRDRGELEDIMFKLFERQPNWALKQLVQETDQPAQFLKEILNELCVYNKRGTN
QGTYELKPEYKKSAEDTGAE
Download sequence
Identical sequences XP_002279990.2.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]