SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002302075.1.11743 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002302075.1.11743
Domain Number 1 Region: 111-216
Classification Level Classification E-value
Superfamily CAD & PB1 domains 9.32e-23
Family PB1 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002302075.1.11743
Sequence length 237
Comment auxin-induced protein aux28 [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence
MEVEKGTKMGFEETELRLGLPGNGGGAEGEMVRKRGFSETVDLKLKLSSKESGADPNHEK
TSSLQREKNLLATDPAKPPAKAQVVGWPPVRSFRKNMLAVQKSSTDQECEKVPGGNATFV
KVSMDGAPYLRKVDLKMYKTYQELSDALGKMFSSFTIGNCGSHGLKDFLNESKLIDLLNG
TDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNRSYK
Download sequence
Identical sequences B9GS70 L0AUG3
XP_002302075.1.11743 POPTR_0002s04580.1|PACid:18245903 3694.grail3.0003037201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]