SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002307646.1.11743 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002307646.1.11743
Domain Number 1 Region: 100-260
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.53e-25
Family CRAL/TRIO domain 0.0011
Further Details:      
 
Domain Number 2 Region: 13-91
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000000000249
Family CRAL/TRIO N-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 272-368
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.0000732
Family Supernatant protein factor (SPF), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002307646.1.11743
Sequence length 384
Comment hypothetical protein POPTR_0005s24620g [Populus trichocarpa]; AA=GCF_000002775.3; RF=representative genome; TAX=3694; STAX=3694; NAME=Populus trichocarpa; AL=Chromosome; RT=Major
Sequence
MVEGAIIDNYLLENPKKSFLRRESEREKQQQREISLWGVPLLPSKGHASTDLVLLKFLTA
TDFKVNEAFKMLRNALKWRNECRIDAIPEENLHLGLEKFVYINSVGKQGQPVYYILYGAF
KDKELYRKVLGTEENREKFLRLRIQLMEKSIEQLSFKAGGADSILQITDLKHSPGPEREE
FRSVHKRASTLIQANYPELIQKHILINVPFWYYTSRFLTSRLKHQRGKKKVVLARPSKVT
KTLLKHISPENLPVKYGGLKRENDIEFFPEDKASELIVKPNSASCIQIPVIEAGVTIVWD
FTVVGWEVTCKQQFIPDDEGSYEVLLRKDKEKKMGDSVRNSFYISEPGKIVITIDNATLK
KKRVYYRSKAKPTAPPYIIFKKQL
Download sequence
Identical sequences B9H8M6
POPTR_0005s24620.1|PACid:18207727 XP_002307646.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]