SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002399891.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002399891.1.51680
Domain Number 1 Region: 58-162
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.05e-23
Family Insect phospholipase A2 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002399891.1.51680
Sequence length 165
Comment phospholipase A2 precursor, putative, partial [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
DTIYTLLNVIPQDIVTYVNQDEMQYFLDLCDNKKEHFMWRPLKSIFNFIDTASHSLVIFP
GTKWCGAGDIAKNYDDLGRESKTDMCCRDHDHAYNTIAPYKTEHGLFNFQFFTMTNCLDD
CKFYDCLLNVSSLASDAVGTIYFNTLASHCFAYGYPPKCVKHNVY
Download sequence
Identical sequences B7QGM3
XP_002399891.1.51680 ISCW014956-PA 6945.ISCW014956-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]