SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002401925.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002401925.1.51680
Domain Number 1 Region: 114-233
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.15e-34
Family cAMP-binding domain 0.0000019
Further Details:      
 
Domain Number 2 Region: 243-368
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-30
Family cAMP-binding domain 0.00000231
Further Details:      
 
Domain Number 3 Region: 13-60
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 3.27e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002401925.1.51680
Sequence length 376
Comment cAMP-dependent protein kinase type I-beta regulatory subunit, putative, partial [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
ESKMASTQEEEQSLRECELYVQKHNIQKLLKDCIVQLCVSRPDNPVSFLREYFARLEKAK
QQQLSPMATTPPGEEREDELSPLPVPPQRNRRGAVSAETYSEEDATSYVKKMVPKDYKTM
AALSKAIEKNVLFSHLDDNERSDIFDAMFPVVHRAGEVIIQQGDEGDNFYVLDQGEVDVY
VNGQLVTTIAESGSFGELALIYGTPRAATVKAKTDVKLWAIDRDTYRRILMGSTIRKRKL
YEEFLSKVSILESLDKWERLTVADALEPVTFNDGDVIVEQGMPGDDFFIIEEGSASVLQR
RSESEPQEEVGRLGPSDYFGEIALLLDRPRAATVVSRGNLKCVKLDRSRFERVLGPCAEI
LKRNMTHYNSLISLSV
Download sequence
Identical sequences B7P8F8
XP_002401925.1.51680 ISCW002971-PA 6945.ISCW002971-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]