SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002403940.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002403940.1.51680
Domain Number 1 Region: 101-128
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.000000832
Family T-box 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002403940.1.51680
Sequence length 128
Comment t-box transcription factor tbx2, putative, partial [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
PLEMRSSPGDAMAFQPFLMPAVRPTPQDFSVHSLLGGAQPPYLPALAGFPASLFPKLHPG
AAGPCPPLTAEDLLAAAHRGAPLLRPPPGLEPEDDGVQDDPKVTLESKELWERFHTFGTE
MVITKSGR
Download sequence
Identical sequences B7PT59
ISCW019286-PA 6945.ISCW019286-PA XP_002403940.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]