SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002410170.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002410170.1.51680
Domain Number 1 Region: 171-306
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.74e-37
Family Galectin (animal S-lectin) 0.00033
Further Details:      
 
Domain Number 2 Region: 7-115
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-32
Family Galectin (animal S-lectin) 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002410170.1.51680
Sequence length 307
Comment galectin, putative [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
MDDCPIPPGFTRLVLNLTSGMGKDDDVALHVNPRFAESAIVRNSLKGGSWGEEERDGEMP
LAIGQPFRLSVAVLEDCFRLTINDAHFADYAHRLSVGSVRNLVVEGDAVIHDVVVESQEN
ELELGQADNWELYQPPEMPREEALQEDQQVTELLAESQIHFEPKLELIQPPKPVCQRIPE
VMTPGRVVIVSGEVEPTAQRFYVNLQTDVGDTADVGLHINPRFDTNPRGVVLNSRDRDQW
QSEVQVTEKFPFVPGSPFELQIHCQEDKFRLIVNGCFLANFPHRIDLSRIDYICVDGSLV
VDRVVFA
Download sequence
Identical sequences B7Q1V4
XP_002410170.1.51680 ISCW008553-PA 6945.ISCW008553-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]