SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002428514.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002428514.1.24195
Domain Number 1 Region: 143-192
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000126
Family Ovomucoid domain III-like 0.0063
Further Details:      
 
Domain Number 2 Region: 66-116
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000319
Family Ovomucoid domain III-like 0.0043
Further Details:      
 
Domain Number 3 Region: 222-272
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000194
Family Ovomucoid domain III-like 0.0051
Further Details:      
 
Weak hits

Sequence:  XP_002428514.1.24195
Domain Number - Region: 44-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0322
Family Follistatin (FS) module N-terminal domain, FS-N 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002428514.1.24195
Sequence length 292
Comment follistatin, putative [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MTKEECCSQFTNVNTAWSNEDMDSGSLFFLRILGDGVPCHSCKETCTGVECGSGKKCVMR
SGRPKCVCSPCKEKGKNSRGPVCGTDGNTYLNVCRIKKRACRRKTPNLTVAYNGFCQSSC
DRIKCPDGKYCLLDQNLSPHCVRCMIRCPKSMENSKPVCGTDGITYENICLLRQMACKKG
KAIPVAYKGKCKARASCGSIRCKDRQACLTDSYSGLPRCVTCTSRCPSVKTKEFRGPICG
TNNKTYHSWCHMVKDACATGFVIETKFQGICEEGGKRSFSIKKNNNFTMIVM
Download sequence
Identical sequences E0VQX0
121224.XP_002428514 XP_002428514.1.24195 vb|PHUM388310-PA|EEB15776.1|follistatin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]