SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002430785.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002430785.1.24195
Domain Number 1 Region: 4-72
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.8e-18
Family Ovomucoid domain III-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002430785.1.24195
Sequence length 82
Comment Elastase inhibitor, putative [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MQPCETTLCSFGSICVTESDGRTHCKCPTSCPITYSPVCGTDDKVYNNECLLRQTSCQKQ
TIIKVLHEGKCGENHVRVLFLL
Download sequence
Identical sequences E0VXE1
XP_002430785.1.24195 vb|PHUM498640-PA|EEB18047.1|Elastase 121224.XP_002430785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]