SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002471045.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002471045.1.31404
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.83e-21
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0000997
Further Details:      
 
Domain Number 2 Region: 79-168
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.53e-21
Family Cold shock DNA-binding domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002471045.1.31404
Sequence length 170
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MFFIKELSHTILLHPSYFGPRMLQFLESKLYSDVEGTCSGQFGYIIAVVSILDIGKGMVI
SGSGQAEFITRYRAIVFKPFKGEVVDGVVNNVNKMGFFADVGPLTVFVSHQLIHPDLKFD
PNSNPPSFASEDQIIEKNTKVRLKIVGTRVDATEIFAIGTIKEDHLGVID
Download sequence
Identical sequences A0A1X6N7X9 B8P5T6
104341.JGI113284 104341.JGI87580 jgi|Pospl1|113284|estExt_Genewise1Plus.C_1900018 jgi|Pospl1|87580|fgenesh3_pm.29__13 XP_002471045.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]