SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002586878.1.56174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002586878.1.56174
Domain Number 1 Region: 323-433
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-29
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 2 Region: 201-310
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-24
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 3 Region: 117-158
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000799
Family Fibronectin type II module 0.004
Further Details:      
 
Domain Number 4 Region: 20-60
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000217
Family Fibronectin type II module 0.0065
Further Details:      
 
Domain Number 5 Region: 158-199
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000314
Family Fibronectin type II module 0.0063
Further Details:      
 
Domain Number 6 Region: 62-104
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000485
Family Fibronectin type II module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002586878.1.56174
Sequence length 514
Comment hypothetical protein BRAFLDRAFT_129826 [Branchiostoma floridae]; AA=GCF_000003815.1; RF=representative genome; TAX=7739; STAX=7739; NAME=Branchiostoma floridae; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MAQFLFIAVLALAASAKGQDCVFPFTYGGTTYHSCTSASSTGFWCSFDAVYSGGWRWCDE
RECTFPFIYNGQTFTTCALGGGLSSNWCSLDAVYDGNYVSCSDDHVIVDPLEDKPEACHF
PFEYQGQTYTTCTLENSSELWCSLDAVYDGNYKYCGEEECVFPFNYNGESYSQCVDIENN
GGWCSLDHNYQGNQVSCAVQPCSETINKDHGTLHSPNYPNSYNHDMDCSYIFPARGGTVF
LEFQDFALETGAAAFGMCEFDYVEIFTGDRSLGTWCGNHGPTNITSNEDVTIHMSTDGSI
ATRGWKLKFTVEGATPFGPGLEECGGQLHGHHGEVESPGFPVAYHNDIDCTWTLEARHSG
VVLEFTDFDLEKPGEYQGCTYDFVEIYNGLNRVGRFCGSSPPPTNTYYAERVSIRFKTDQ
HTVARGFRFNWTYLHAETTPELPTTPEKATTPEPEINPGPATTPEPEINPEPATTPEPEI
NPEPATTPEPEINPGPGTTPESGTAPVIAHTHKE
Download sequence
Identical sequences C3ZX60
7739.JGI129826 XP_002586878.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]