SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002587569.1.56174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002587569.1.56174
Domain Number 1 Region: 47-95
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000392
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 10-47
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000116
Family Somatomedin B domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002587569.1.56174
Sequence length 234
Comment hypothetical protein BRAFLDRAFT_230525, partial [Branchiostoma floridae]; AA=GCF_000003815.1; RF=representative genome; TAX=7739; STAX=7739; NAME=Branchiostoma floridae; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
QCCTGRDAFCHNYGLRTDNRYGPCYCDEACTAQQDCCQDYTWICIPVDCEVGEWSGWSAC
TSSCDIGFAERRRRVTKEPKNGGKACPPEVERRGCYEWDARKCDPATAGQNKMWLKKHNR
IKTKLYQILRFQVFCFLCFSYCVFFYMNEVPTTCILHRQAGQWTHALQPRSTVCVECQPA
AMDRNGRCSGDGVDDASTLWKAMGVTGCQGSWLRAEKRDDCNCGDRPGTDFLFV
Download sequence
Identical sequences C3ZV65
XP_002587569.1.56174 7739.JGI230525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]