SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002592411.1.56174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002592411.1.56174
Domain Number 1 Region: 241-385
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.22e-52
Family A middle domain of Talin 1 0.00000602
Further Details:      
 
Domain Number 2 Region: 4-94
Classification Level Classification E-value
Superfamily Second domain of FERM 9.03e-24
Family Second domain of FERM 0.0000394
Further Details:      
 
Domain Number 3 Region: 95-158
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000177
Family Third domain of FERM 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002592411.1.56174
Sequence length 412
Comment hypothetical protein BRAFLDRAFT_67277 [Branchiostoma floridae]; AA=GCF_000003815.1; RF=representative genome; TAX=7739; STAX=7739; NAME=Branchiostoma floridae; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MELARDGILNGTHPVTVDEAMMFAAYQTQIQFGDHIETKHKSGFLDLKEFLPKEYVKNKG
IEKKIWLEHRKLAGLSELDAKVRYTQQCRSLKTYGVTFFLVKEKMKGKNKLVPRLLGITK
DSVMRVDEKTKEILKVWPLTTVRRWAASPKSFTLKKGKDRFGLDGEEESTMLEDSVSPAR
ATIMQHQENKVGHVNEGSVAIPAVMRAHDGAESYSTGTMPRAEYATIRGQIHSAHMPPIN
TQAQQALMGNISSGFNSISAAQAELGSRAELPPLGSDPASLKWKQNTLDVSKQNVTSQLA
AMSAATASVVTLTSGEPEQTDYTAVGSAVTTISSNLTEMSKGIKMVAALLEDYGQGERLL
DAARNLAGAFSDLLSAAKPGSTEGPDLYEACRQLMIAEHEFLDQIQPYLPGV
Download sequence
Identical sequences C3ZGA1
7739.JGI67277 XP_002592411.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]