SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002597364.1.56174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002597364.1.56174
Domain Number 1 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-26
Family Second domain of FERM 0.00084
Further Details:      
 
Domain Number 2 Region: 216-288
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-21
Family Third domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 20-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.82e-20
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002597364.1.56174
Sequence length 316
Comment hypothetical protein BRAFLDRAFT_66499 [Branchiostoma floridae]; AA=GCF_000003815.1; RF=representative genome; TAX=7739; STAX=7739; NAME=Branchiostoma floridae; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MTLDEAEFNESSSSCCSMAEGRRCQVQLLDDRKLEFLIQPKLQSSDLLDLVASHFNLKEK
EYFGLAYHDETHHLNWLQADRRVLEHEFPRRAGTLTLQFSVRFYIESIAYLRDPVTIELF
FLQAKSSIFKAQLEVDSETAFELAAYVLQATHGDYTSDENARNDLKKLPVLPTSALKEHP
SLSYCEDRVIAHYKKFNGQSRGQAIVNYMSIVESVPNYGVHYYEVKDKGGIPWWLGLSYK
GIAQYDHSDKLTPRKIFQWRQLENLYFREKKFSIEVHDPRRVVHALSTYSVYDDALAEPL
EELDDLTDAISDPSTL
Download sequence
Identical sequences C3Z2X5
7739.JGI66499 XP_002597364.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]