SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002598960.1.56174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002598960.1.56174
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 7.31e-22
Family Insect phospholipase A2 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002598960.1.56174
Sequence length 118
Comment hypothetical protein BRAFLDRAFT_161598, partial [Branchiostoma floridae]; AA=GCF_000003815.1; RF=representative genome; TAX=7739; STAX=7739; NAME=Branchiostoma floridae; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
LFSGTNWCGTGPAPPNSTLGKNNGTDSCCQQHKQCDDVVEGYQRTDYYQNMRPWRISHCD
CDRQLYDCLAAVNTSVSYTVAFTYFHDFNPTCFERRRKEICTEHDDWFSCKKIEKVKV
Download sequence
Identical sequences C3YY13
7739.JGI161598 XP_002598960.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]