SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002607707.1.56174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002607707.1.56174
Domain Number 1 Region: 19-101
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000137
Family Snake venom toxins 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002607707.1.56174
Sequence length 133
Comment hypothetical protein BRAFLDRAFT_123261 [Branchiostoma floridae]; AA=GCF_000003815.1; RF=representative genome; TAX=7739; STAX=7739; NAME=Branchiostoma floridae; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MSGRLLLLVALVSIVTVSYGLDCIQCVAPSASDNCQTQSTATNATTCSAGTYCAVISVTT
GGSWTSFVRSCTATNTGAGCLEVATVRTCSTYCTTDGCNTGDGTGGGAGMVRASALFLIV
SAILSAILGTAVY
Download sequence
Identical sequences C3Y789
XP_002607707.1.56174 7739.JGI123261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]