SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002607899.1.56174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002607899.1.56174
Domain Number - Region: 42-90
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0647
Family BRCA2 tower domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002607899.1.56174
Sequence length 152
Comment hypothetical protein BRAFLDRAFT_74852 [Branchiostoma floridae]; AA=GCF_000003815.1; RF=representative genome; TAX=7739; STAX=7739; NAME=Branchiostoma floridae; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MASRWVYMWTTVVLLLVASAMVDGSEDDTKSDKVTSKAWKSHHVNNPQQKRLKEASAHRN
RKDKTLEKLFHEVKRNVQGWQTRLGKKATEDNTDYLVRVTSKKYVVCLYLVQICKPEHNA
SVIRGTTGGLHDGDGFADDDTKFAVLLIAVMN
Download sequence
Identical sequences C3Y6E9
XP_002607899.1.56174 7739.JGI74852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]