SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002647498.1.8413 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002647498.1.8413
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.35e-31
Family Cofilin-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002647498.1.8413
Sequence length 165
Comment C. briggsae CBR-UNC-60 protein [Caenorhabditis briggsae]; AA=GCF_000004555.1; RF=representative genome; TAX=6238; STAX=6238; NAME=Caenorhabditis briggsae; strain=AF16; AL=Chromosome; RT=Major
Sequence
MSSGVMVDPDVQTSFQKLSEGRKEYRYIIFKIEDNKVIVESAVTQDQLELTGDDYDDSSK
AAFEKFAADIKSRTNGLTDCRYAVFDFKFTCSRVGAGTSKMDKIIFLQICPDGASIKKKM
VYASSAAAIKASLGTGKILQFQVSDEPEMNHKEFLNKLGEKYGDH
Download sequence
Identical sequences XP_002647498.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]