SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002682195.1.8020 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002682195.1.8020
Domain Number 1 Region: 66-197
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 8.33e-19
Family Cofilin-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002682195.1.8020
Sequence length 199
Comment predicted protein [Naegleria gruberi strain NEG-M]; AA=GCF_000004985.1; RF=representative genome; TAX=5762; STAX=5762; NAME=Naegleria gruberi; strain=NEG-M; AL=Scaffold; RT=Major
Sequence
MIDETRLQTEQAVTITLIDFCPLQNSFKDSPEDTHFTLLRDKLREIQKAHLFNSKPSMLL
MKRQSKIVFQDLKLGKGGYKNLLVLQLDPSLQEPTLTIDHQLSQHTTLEQLIPHLPSNSP
RFICYNLHYEMPSYSTSREGERSKIILITWCPKECGVRERFKTALGVQFLLNNLNGLSAT
VHATSSRALTHQSLVKQVL
Download sequence
Identical sequences D2V017
jgi|Naegr1|62137|fgeneshNG_pg.scaffold_3000006 XP_002682195.1.8020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]