SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002697168.3.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002697168.3.76553
Domain Number 1 Region: 30-526
Classification Level Classification E-value
Superfamily Sema domain 9.55e-100
Family Sema domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1390-1515,1681-1837
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.24e-33
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 867-958
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000486
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 958-1048
Classification Level Classification E-value
Superfamily E set domains 0.000000000000168
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.056
Further Details:      
 
Domain Number 5 Region: 1046-1126
Classification Level Classification E-value
Superfamily E set domains 0.0000000000691
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 
Domain Number 6 Region: 529-580
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000593
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002697168.3.76553
Sequence length 1905
Comment PREDICTED: plexin-D1 isoform X1, partial [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
FRAPQCPPPPLLLWLLLLLGAARIGALEIQRRFPSPTPTNNFALDGAAGTVYLAAVNRLY
QLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPGQGLVVVC
GSIYQGFCQLRRRGNISAVAVPFPPAAPPAAPVTVFPSMLNVAANHPNASTVGLLLPPAA
GAGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPEIAIRSLDARGDLAKLFTFDLNPS
DDNILKIKQGAKEQHKLGFVRAFLHPPDPRPGAQTYAYLALNSEARAGDKESQARSLLAR
ICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVSVFPTRELLFAVFERPQGTPA
ARAAPAALCAFRFADVQAAIRAARTACFVDPAPDVVAVLDSVVQGTGPACERKRNIQLQP
EQLDCGAAHLQHPLSVLQPLKALPVFRAPGLSSVAVASVGNYTVVFLGTVSGRLLKINLN
ESMQVVSRKVVTVAYGEPVHHVMQFDPADPGYLYLMTSHQMARVKVAACAAHTTCGDCVG
AADAYCGWCALETRCTLQQDCANSSQPHFWTSASAGPGRCPAMTVLPAEIDVHQEYPGMI
LQISGSLPSLSGMEMACDYGHGIHTVARVPGPAFGHQIAYCNLLPKDQFPPFPPHQDHVT
VEMSVRVRGQNIVRASFTIYDCGRVGQVYPHTACTSCLSAQWPCVWCAQQHACVSNQSRC
EASPNPTSPQECPQILPSALAPMPTGGSQSIPVHLASAAFFQGAALECSFGLEETFEAVW
VNESAVRCKHVVLHTTQKSQVFPLSLQLKGRPARFLDSPDPMTVEVYNCAVGSPDCSQCL
GREDLGHLCVWSDGCRPRGTLQPTPGTCPAPEIRAIEPLSGPLDGGTQLTIRGRNLGRRF
SDVAHGVWIGGVACEPLADRYTVSEEIVCATGPAPEAFSDVVTVNASKEGRSRERFSYVL
PLVHSLEPAMGPKAGGTRITIHGSELHVGSELQVLVNNTEPCTELLRSDASIACTVPGGT
LPAMVPVCVRFEQRGCVRGGLSFQYMPNPVITAISPHRSHVSGGRTITVAGERFHMVQKV
SMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFFLNGRVYADEAAVAEELLEPE
EAQRGSQFRLDYLPDPQFSTAKREKWIKHHPGEPLTLVIHKEQDGLGLESHEYRVKIGQV
ACDIQIVSERVIHCSVNESLGTAEGQLPITIQVGNFNQTIATLQLGGSETAIIVSIVICS
VLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKEL
NRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNSQGSSPVQETHPLLGEWKIPE
SCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYT
GIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCA
IKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTL
TQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLA
HYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLP
EIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLH
IWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTN
KLLYAKEIPEYRKIVQCYYKQIHDMTPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKY
AKRYRPQIMSALEANPTARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_002697168.3.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]