SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002710156.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002710156.1.1745
Domain Number 1 Region: 11-153
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 8.25e-46
Family Nucleoside diphosphate kinase, NDK 0.00021
Further Details:      
 
Weak hits

Sequence:  XP_002710156.1.1745
Domain Number - Region: 157-194
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002710156.1.1745
Sequence length 211
Comment PREDICTED: nucleoside diphosphate kinase homolog 5 isoform X1 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MEVSMSPPQIYVEKTLAIIKPDVVDKEEEIQDIILRSGFTIVQRRKLRFSPEQCSNFYVE
QYGKMFFPNLTVYMSSGPLVAMILARHKAISYWKELLGPSNSLIAKETHPDSLRAIYGTD
DLRNALHGSNDFAAAEREIRFMFPKVIVEPIPVGQAAKDYLNLYVIPTLLEGLTKLCKQK
PADPFIWLADWLLKNNPNKPKLCHHPNTEQC
Download sequence
Identical sequences G1U1P7
9986.ENSOCUP00000023283 ENSOCUP00000023283 XP_002710156.1.1745 XP_008253300.1.1745 ENSOCUP00000023283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]