SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002733422.1.86028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002733422.1.86028
Domain Number 1 Region: 82-125
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000146
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002733422.1.86028
Sequence length 131
Comment PREDICTED: uncharacterized protein LOC100370798 [Saccoglossus kowalevskii]; AA=GCF_000003605.2; RF=representative genome; TAX=10224; STAX=10224; NAME=Saccoglossus kowalevskii; AL=Scaffold; RT=Major
Sequence
MAAAVQEPGDDVQKILLTQGDVSENPTPIPDHVNKEMSPSVMPNAVGQSTGLLEEKLKES
LRVDDNESTEYISPIEDPYTRAVKYLERYNVMHIFQQLTASLVFHRPEDPLQFLLDEILK
IQKEKEATLAE
Download sequence
Identical sequences XP_002733422.1.86028 Sakowv30046317m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]