SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002767966.1.22384 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002767966.1.22384
Domain Number - Region: 74-104
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.033
Family Retrovirus capsid protein C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002767966.1.22384
Sequence length 223
Comment hypothetical protein Pmar_PMAR023895 [Perkinsus marinus ATCC 50983]; AA=GCF_000006405.1; RF=representative genome; TAX=423536; STAX=31276; NAME=Perkinsus marinus ATCC 50983; strain=ATCC 50983; AL=Scaffold; RT=Major
Sequence
MGQASQLLQKTCHDGVGGMLCPQFDAFSQITVCFIAEKRVLSCAAGFKARVEAIWRVLEH
TYSNAVVRDKLKTQWKQLRRNPAESCRDFISRVQNARKELQYSGALVEDSDEISIWRNGL
FGPYNDWVGQYLAVAAVEGHPYGPRSIQQLRAEIQIRGDEYEDRHGIVAVPSTSTSLSAG
PPGSSEQGGLYTATQQQSQTRQDQPISKPTGSGANDAMPRIIR
Download sequence
Identical sequences C5LRF2
gi|294877351|ref|XP_002767966.1| XP_002767966.1.22384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]