SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002780339.1.22384 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002780339.1.22384
Domain Number 1 Region: 17-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002780339.1.22384
Sequence length 84
Comment hypothetical protein Pmar_PMAR019241 [Perkinsus marinus ATCC 50983]; AA=GCF_000006405.1; RF=representative genome; TAX=423536; STAX=31276; NAME=Perkinsus marinus ATCC 50983; strain=ATCC 50983; AL=Scaffold; RT=Major
Sequence
MEPSGVEATGERIFCPEQIQIPQQLHEVLKDLTKEVIRCNPVGVDKVSDEEAQARIYKFA
IKLCEQKLEALNGNTALSDSKVEG
Download sequence
Identical sequences C5KU92
XP_002780339.1.22384 gi|294932571|ref|XP_002780339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]