SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002810263.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002810263.1.23681
Domain Number 1 Region: 37-76
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000262
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002810263.1.23681
Sequence length 92
Comment PREDICTED: RIIa domain-containing protein 1 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
METVPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTNKEVEWLISGFFREIFLKR
PDDILKCAADYFTDPRLPNKIHMQLIKDKKAA
Download sequence
Identical sequences H2N5U7
ENSPPYP00000001002 XP_002810263.1.23681 ENSPPYP00000001002 9600.ENSPPYP00000001002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]