SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002819546.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002819546.1.23681
Domain Number 1 Region: 22-101
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000000729
Family Snake venom toxins 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002819546.1.23681
Sequence length 125
Comment PREDICTED: ly6/PLAUR domain-containing protein 2 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MRGTRLALLALVLAACGELVPALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIV
YPFQGDSTVTKSCASKCEPSDVDGIGQTRPVSCCNTELCNVDGAPSLNSLHCGALPLLPL
LSLQL
Download sequence
Identical sequences H2PRB6
ENSPPYP00000021226 ENSPPYP00000021226 9600.ENSPPYP00000021226 XP_002819546.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]