SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002827073.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002827073.1.23681
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily EF-hand 1.26e-44
Family Calmodulin-like 0.0000000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002827073.1.23681
Sequence length 200
Comment PREDICTED: recoverin [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDT
DPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKMKNA
Download sequence
Identical sequences G3QZN4 H2NSQ6 H2QC95 P35243
ENSP00000226193 ENSPTRP00000014928 gi|4506459|ref|NP_002894.1| ENSPPYP00000008969 ENSP00000226193 ENSGGOP00000008349 ENSPTRP00000014928 hsi002004436.1 ENSPPYP00000008969 9598.ENSPTRP00000014928 9600.ENSPPYP00000008969 9606.ENSP00000226193 NP_002894.1.87134 NP_002894.1.92137 XP_002827073.1.23681 XP_003818145.1.60992 XP_004058625.1.27298 XP_009431030.1.37143 ENSGGOP00000008349 ENSP00000226193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]