SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002841532.1.11696 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002841532.1.11696
Domain Number 1 Region: 1-26
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.00000283
Family ISP transmembrane anchor 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002841532.1.11696
Sequence length 83
Comment hypothetical protein [Tuber melanosporum Mel28]; AA=GCF_000151645.1; RF=representative genome; TAX=39416; STAX=39416; NAME=Tuber melanosporum; strain=Mel28; AL=Scaffold; RT=Major
Sequence
MVGTMGLLSAAGAKATIQDFLVNLSAWTFPLSQRARMSSSSGAANPSLSATAPPTKSKRP
TPSRWRPCAIPKPTLSASSSPSG
Download sequence
Identical sequences D5GMI0
XP_002841532.1.11696 GSTUMT00010737001 CAZ85723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]