SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002879310.1.15461 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002879310.1.15461
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.35e-44
Family Cofilin-like 0.00000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002879310.1.15461
Sequence length 146
Comment hypothetical protein ARALYDRAFT_902145 [Arabidopsis lyrata subsp. lyrata]; AA=GCF_000004255.2; RF=representative genome; TAX=81972; STAX=59689; NAME=Arabidopsis lyrata subsp. lyrata; AL=Scaffold; RT=Minor
Sequence
MSFRGLSRPNATSGMGVADQSKTTFLELQRKKTHRYVVFKIDESKKQVVVEKTGNPAESY
DDFLASLPENDCRYAVYDFDFVTSENCQKSKIFFFAWSPSTSRIRAKVLYSTSKDQFRRE
LQGIHYEIQATDPTEVDLEVLRERAN
Download sequence
Identical sequences D7LD02
XP_002879310.1.15461 jgi|Araly1|902145|scaffold_401646.1 59689.scaffold_401646.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]