SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002889159.1.15461 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002889159.1.15461
Domain Number - Region: 112-141
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0484
Family SIAH, seven in absentia homolog 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002889159.1.15461
Sequence length 264
Comment hypothetical protein ARALYDRAFT_476943 [Arabidopsis lyrata subsp. lyrata]; AA=GCF_000004255.2; RF=representative genome; TAX=81972; STAX=59689; NAME=Arabidopsis lyrata subsp. lyrata; AL=Scaffold; RT=Minor
Sequence
MGKFKKANQRGHIATPYPSPCCKKEWAGSTCPVCLESPHNAVLLLCSSYHKGCRPYMCAT
SSRFANCLEQYRKSYSNENSGQPELLCPLCRGQVKGWTVVKDARMHFNSKRRTCMQDNCS
FLGNFRKLKKHMKEKHPHACPRAIDPALETKWKRLERERDRRDVISTIMSSTPGAVVLGD
YVIEPHNRAVYDEEDEEEDYSSDDSLSNGILDLESSWQGQSHHIRFLDMESSDFASSSSS
PASPSRSLHRLLFPRNQRGGNRGR
Download sequence
Identical sequences D7KUM6
jgi|Araly1|476943|fgenesh2_kg.2__2073__AT1G77770.2 XP_002889159.1.15461 59689.fgenesh2_kg.2__2073__AT1G77770.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]