SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002960354.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002960354.1.77236
Domain Number 1 Region: 11-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000785
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002960354.1.77236
Sequence length 197
Comment hypothetical protein SELMODRAFT_402537 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MDLDYDPIYCVEQIQIPPALPDILKGFAKEAIRSQPPCLHEFACTYFQRLLATAKLDATA
PPPTLAQLQAVWVDLKDTESMNPETLREICASHGIASAAFSKVFQLIEFPSDPVDPKEIL
VLLVTTTAKSWEWCSFCNTGSDSRMSFVAVIDALFKVFGHKTGGKMSVPLFFKILFFMAK
RDRDISPQTVSDLTKSL
Download sequence
Identical sequences D8QQZ6
jgi|Selmo1|402537|fgenesh2_pg.C_scaffold_0000542 XP_002960354.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]