SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002968725.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002968725.1.77236
Domain Number 1 Region: 63-223
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.84e-32
Family CRAL/TRIO domain 0.00098
Further Details:      
 
Domain Number 2 Region: 14-56
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000366
Family CRAL/TRIO N-terminal domain 0.0028
Further Details:      
 
Domain Number 3 Region: 238-336
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.00000000235
Family Supernatant protein factor (SPF), C-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002968725.1.77236
Sequence length 339
Comment hypothetical protein SELMODRAFT_450422, partial [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
LWGIPLLHTEGDERTDVILGKFLKARDFKVSQALAMLKNCVLWRKSFKADEILDEELGAD
FDGMAFMFGEDKEGHPVCYNVFGVLQDKDLYSKVFGDDAARFLRWRVQLQEKGVKMLKLE
PSTPNALLQVIDLKNAPWPAKKVRSVLLKAISLLQDNYPELVIKNVFINVPWYYSAVFSL
LSPFLTQHQKNKFVVTRLGKSTEALFKLISPEKVPIQYGGLGRAGDEEFSGADAPVTELP
IKAGEKKTVELAVTTGGSSITWDLVVVGSEVSYGAEFQPDQEGGYTTIIVKTKKISAQLE
EPIRNSFKASEPGKVVLSIDNSLSKKKKSVVYRHIVKAA
Download sequence
Identical sequences D8RCE9
XP_002968725.1.77236 jgi|Selmo1|90159|e_gw1.11.965.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]