SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002988914.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002988914.1.77236
Domain Number - Region: 42-76
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.000392
Family PspA lactotransferrin-binding region 0.0091
Further Details:      
 
Domain Number - Region: 17-49
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0955
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002988914.1.77236
Sequence length 90
Comment hypothetical protein SELMODRAFT_229416 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MDGAKKEPYDTGDAAQSTADLTAFVQNLLQQMQARFQTMSDSIITKIDEMGNRIDDLEKS
IGELVKEVGADTPASGSSKPKALQSEASEQ
Download sequence
Identical sequences D8RV05
XP_002974904.1.77236 XP_002988914.1.77236 jgi|Selmo1|229416|fgenesh1_kg.C_scaffold_92000007 jgi|Selmo1|271113|estExt_fgenesh1_kg.C_260002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]