SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002992739.1.77236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002992739.1.77236
Domain Number 1 Region: 236-626
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.97e-93
Family Regulator of chromosome condensation RCC1 0.00041
Further Details:      
 
Domain Number 2 Region: 14-125
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-23
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 
Domain Number 3 Region: 628-694
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.49e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002992739.1.77236
Sequence length 982
Comment hypothetical protein SELMODRAFT_430894 [Selaginella moellendorffii]; AA=GCF_000143415.3; RF=representative genome; TAX=88036; STAX=88036; NAME=Selaginella moellendorffii; AL=Scaffold; RT=Major
Sequence
MELARCGAASLDRDVEQAIIALKKGSQLLKYGRRGRPKFAPFRLSNDETTLIWFSGRKER
QLRLDAVTKIIPGQRTANFQRYPRPEKEYQSFSLIYGSGGEERSLDLICKDKDEAEVWFV
GLKARVSSNRTLKVDNKSEGTLSDVNSPLGRALRDSPLNSYDSFNRSPYGSPSLFKTAST
GELQSVESAKSDSLASEESLNAQGRSVSLADAFRVSMSSAVSSSSQGSGPEDSDALGDVF
IWGEGAGEGFLGGGVCKLTSGAGSRVDSLVPKALQAAVVLDVSSIACGSRHAALVTKQGD
VFCWGEEYGGRLGHGIDVDVSEPQLVQALAGVNTELVACGDFHTCAVTLSGELYTWGADA
QSGGLVGHSNPVSHWMPKRMSSPLEGVRISSIACGAWHTALVSSAGQLFTFGDGTFGVLG
HGDKRNLAIPKEVESLKGLKTVRAACGIWHTAAVVEVIVGYSSATSCSSGKLFTWGDGDK
YRLGHGDKEQKLVPTCVAALVDYNFRQVACGHSLTVALTTSGRVFTMGSTIYGQLGNPKA
DGKVPGMVDGELARTFVEEIGCGAHHVAALSSKTEIYTWGKGANGRLGHGDVEDRTAPTL
VEALRDKQVKTVACGSSFTAVICLHKPVSDADQSVCSGCKQAFGFTRKRHNCYNCGLAYC
HSCSSKKAFRASLAPNPSKAYRVCEPCLAKLERSASEEVARKSRKYMDGRERPLIRASKP
IEMKQVGYYGNSRNTDDFAAKHQTVINIPTAIPERKAVSAKPSPPRSATPTPTSAGLAPP
GNGPDELQKKLELSRQEVLHLKTQISTLTSKYEQRERELRRGAQKVQEAVLLAGEETAKC
RAAKEVIKSLTVELKELAERMPSARRQQQRQEVPNGRHFPAPEAEIDLRLQTSPTSSNSA
TDTTVDKLVLGSGPEEWVEQDQAGVYITLALAPGGGRDLKRVRFSRRRFSEKEAEQWWQD
NRVRVHQQYSIIRTSNTSKNPT
Download sequence
Identical sequences D8TAV6
XP_002992739.1.77236 jgi|Selmo1|430894|fgenesh2_pg.C_scaffold_140000015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]